PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB01G42420.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 725aa    MW: 79388.6 Da    PI: 7.8816
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB01G42420.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox40.25.9e-1386140256
                   T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
      Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                   r+ ++++keq e+ e +F  + +p++ ++++L++ +gL  +qVk+WFqN+R++ k
  OB01G42420.1  86 RRLQRLNKEQSEIIEGFFCICGHPDEGQKRHLSQATGLGLDQVKFWFQNKRTQVK 140
                   455789*********************************************9877 PP

2START93.34.7e-302384532205
                   HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S...EEEEEEEEC CS
         START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla...kaetlevis 86 
                   la  a+  l+ +a+a  ++W  ++    e +n + + q  + +++     +++ea ra ++v m++   v  l+d    + + ++   + +++++i 
  OB01G42420.1 238 LAKNAMHGLIILAEAHVALWLPVPgysfETLNMTAYQQAYPGGDGanalgFRTEATRADAMVMMDHKSIVDFLMDPY-SYRTFFPgviSGAVTNRIY 333
                   677889999999999999***999999888888888888877777999*******************7777777666.8888887777888888887 PP

                   TT.......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SS CS
         START  87 sg.......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdlkgr 175
                   s        g++qlm+ e++++splvp R+ +f+Ry++ l++g  v+vdvS+d+ +  +      ++++ pSg+li+++  + +kv  +ehv +++ 
  OB01G42420.1 334 SWptndgynGVIQLMTVEMMFPSPLVPtRKCTFLRYCKVLEEGAVVVVDVSLDNGSGLS------KCRKMPSGFLIRSVRPNACKVAAIEHVRVDDT 424
                   6666679**********************************************998876......69****************************** PP

                   XXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
         START 176 lphwllrslvksglaegaktwvatlqrqce 205
                    +h+l+++ +  gl++ga++wvat+ rq +
  OB01G42420.1 425 GIHELYQPCLD-GLIFGARRWVATMARQSA 453
                   ********995.89***********99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.8E-1570140IPR009057Homeodomain-like
SuperFamilySSF466897.7E-1577143IPR009057Homeodomain-like
PROSITE profilePS5007113.79982142IPR001356Homeobox domain
CDDcd000861.05E-1183140No hitNo description
SMARTSM003897.7E-984146IPR001356Homeobox domain
PfamPF000461.9E-1086140IPR001356Homeobox domain
PROSITE patternPS000270117140IPR017970Homeobox, conserved site
PROSITE profilePS5084819.36228457IPR002913START domain
SuperFamilySSF559615.36E-19231452No hitNo description
CDDcd088752.08E-87233453No hitNo description
SMARTSM002342.4E-10237454IPR002913START domain
PfamPF018528.0E-23239453IPR002913START domain
SuperFamilySSF559612.04E-9472677No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 725 aa     Download sequence    Send to blast
MEMNQQQSGG NLSSMAPMNG VAGGAATRLM IDRNPASIFT CRYPLMDIDS RLSLHINDVE  60
QTGATVEAGS GSSAGNSNNT HERKKRRLQR LNKEQSEIIE GFFCICGHPD EGQKRHLSQA  120
TGLGLDQVKF WFQNKRTQVK TTCWKEDNYK LTVENEILRD ENRRIKIAHC YAICLTCRNS  180
AVHNQLAAEM ERIKGQTEWL QQEIARSNGA NANLAFQLDS SAENLFSGQH DHQMIAELAK  240
NAMHGLIILA EAHVALWLPV PGYSFETLNM TAYQQAYPGG DGANALGFRT EATRADAMVM  300
MDHKSIVDFL MDPYSYRTFF PGVISGAVTN RIYSWPTNDG YNGVIQLMTV EMMFPSPLVP  360
TRKCTFLRYC KVLEEGAVVV VDVSLDNGSG LSKCRKMPSG FLIRSVRPNA CKVAAIEHVR  420
VDDTGIHELY QPCLDGLIFG ARRWVATMAR QSARLRDVYL SKTALQVSTK GRKNLMKLAD  480
DLLASYASSV SATGAGTWTV VIGAGTEKDV RVAYRGITEG SSSTNAVLSV SASLRLPLPM  540
RKIFDLLRNL TLRSKWDVLV HGSTVKEEVS IARGVGSDDA VTVLHVKRAP GENKERTMIL  600
QNNGYDVSGS FIVYSPIDSK LMDTMVLGPS ELPSGASGLS LYPTGFSLLP DGEAARESSG  660
MDLGDVGGTL MTLGFQIPVK LATGNGMYPR SVTSAIRLMT DTIGIMKRTL MEDHSDIYGS  720
GPFNA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006646400.10.0PREDICTED: homeobox-leucine zipper protein TF1
SwissprotQ5ZAY00.0TF1_ORYSJ; Homeobox-leucine zipper protein TF1
TrEMBLJ3L4T60.0J3L4T6_ORYBR; Uncharacterized protein
STRINGOB01G42420.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP104752833
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.11e-108protodermal factor 2